SCOPe 2.06: Domain d1hxga2: 1hxg A:221-548

Lineage for d1hxga2 (1hxg A:221-548)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
   automatically mapped to Pfam PF03936

6. Protein 5-Epi-aristolochene synthase [48584] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48585] (7 PDB entries)

8. Domain d1hxga2: 1hxg A:221-548 [83646]
   Other proteins in same PDB: d1hxga1
   complexed with mg

Details for d1hxga2

PDB Entry: 1hxg, 2.9 Å

PDB Description: crystal structure of teas w273s/c440w

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d1hxga2:

Sequence; same for both SEQRES and ATOM records:

>d1hxga2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfsalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviiwrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpeevlkphiinllvdsiki

Timeline for d1hxga2:

• d1hxga2 first appeared in SCOP 1.65
  
• d1hxga2 appears in SCOPe 2.05
  
• d1hxga2 appears in SCOPe 2.07
  
• d1hxga2 appears in the current release, SCOPe 2.08