Lineage for d1hxaa1 (1hxa A:21-220)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.1: Terpenoid cylase N-terminal domain [48240] (2 proteins)
incomlete toroid made of four haipins
Protein 5-Epi-aristolochene synthase [48241] (1 species) Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries) 
Domain d1hxaa1: 1hxa A:21-220 [83641]
Other proteins in same PDB: d1hxaa2
complexed with fhp, mg; mutant
Details for d1hxaa1
PDB Entry: 1hxa (more details), 2.32 Å
PDB Description: crystal structure of teas w273s form 2
SCOP Domain Sequences for d1hxaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxaa1 a.102.4.1 (A:21-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum)}
spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis
yhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkesl
asdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhk
gvprvetrffissiydkeqs
SCOP Domain Coordinates for d1hxaa1:
Click to download the PDB-style file with coordinates for d1hxaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hxaa1:
- d1hxaa1 is new in SCOP 1.65
- d1hxaa1 appears in SCOP 1.67
- d1hxaa1 appears in the current release, SCOPe 2.08
View in 3D
