SCOPe 2.08: Domain d1hx9a1: 1hx9 A:21-220

Lineage for d1hx9a1 (1hx9 A:21-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein 5-Epi-aristolochene synthase [48241] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries)

8. Domain d1hx9a1: 1hx9 A:21-220 [83639]
   Other proteins in same PDB: d1hx9a2
   complexed with fhp, mg

Details for d1hx9a1

PDB Entry: 1hx9, 3.5 Å

PDB Description: crystal structure of teas w273s form 1

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d1hx9a1:

Sequence, based on SEQRES records:

>d1hx9a1 a.102.4.1 (A:21-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis
yhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkesl
asdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhk
gvprvetrffissiydkeqs

Sequence, based on observed residues (ATOM records):

>d1hx9a1 a.102.4.1 (A:21-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis
yhfekeiddildqiynqdlctsalqfrllrqhgfnispeifskfqdengkfkeslasdvl
gllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhkgvprv
etrffissiydkeqs

Timeline for d1hx9a1:

• d1hx9a1 first appeared in SCOP 1.65
  
• d1hx9a1 appears in SCOPe 2.07