Lineage for d1hu9a2 (1hu9 A:9-167)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554678Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 554679Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 554680Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 554684Protein Plant lipoxigenase [49725] (2 species)
  7. 554694Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (9 PDB entries)
  8. 554698Domain d1hu9a2: 1hu9 A:9-167 [83632]
    Other proteins in same PDB: d1hu9a1
    complexed with 4hm, fe

Details for d1hu9a2

PDB Entry: 1hu9 (more details), 2.2 Å

PDB Description: lipoxygenase-3 (soybean) complex with 4-hydroperoxy-2-methoxy-phenol

SCOP Domain Sequences for d1hu9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hu9a2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

SCOP Domain Coordinates for d1hu9a2:

Click to download the PDB-style file with coordinates for d1hu9a2.
(The format of our PDB-style files is described here.)

Timeline for d1hu9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hu9a1