Class b: All beta proteins [48724] (149 folds) |
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) |
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
Protein Plant lipoxigenase [49725] (2 species) |
Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (9 PDB entries) |
Domain d1hu9a2: 1hu9 A:9-167 [83632] Other proteins in same PDB: d1hu9a1 complexed with 4hm, fe |
PDB Entry: 1hu9 (more details), 2.2 Å
SCOP Domain Sequences for d1hu9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hu9a2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3} ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv sltledipnhgsihfvcnswiynaklfksdriffanqty
Timeline for d1hu9a2: