Lineage for d1hu9a1 (1hu9 A:168-857)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543291Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 543292Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 543293Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 543294Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 543304Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (9 PDB entries)
  8. 543308Domain d1hu9a1: 1hu9 A:168-857 [83631]
    Other proteins in same PDB: d1hu9a2
    complexed with 4hm, fe

Details for d1hu9a1

PDB Entry: 1hu9 (more details), 2.2 Å

PDB Description: lipoxygenase-3 (soybean) complex with 4-hydroperoxy-2-methoxy-phenol

SCOP Domain Sequences for d1hu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hu9a1 a.119.1.1 (A:168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOP Domain Coordinates for d1hu9a1:

Click to download the PDB-style file with coordinates for d1hu9a1.
(The format of our PDB-style files is described here.)

Timeline for d1hu9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hu9a2