Lineage for d1ht6a2 (1ht6 A:1-347)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305662Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 305948Protein Plant alpha-amylase [51474] (2 species)
  7. 305949Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (1 PDB entry)
  8. 305950Domain d1ht6a2: 1ht6 A:1-347 [83630]
    Other proteins in same PDB: d1ht6a1
    complexed with ca, edo

Details for d1ht6a2

PDB Entry: 1ht6 (more details), 1.5 Å

PDB Description: crystal structure at 1.5a resolution of the barley alpha-amylase isozyme 1

SCOP Domain Sequences for d1ht6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOP Domain Coordinates for d1ht6a2:

Click to download the PDB-style file with coordinates for d1ht6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ht6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ht6a1