Lineage for d1hq4c2 (1hq4 C:108-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289891Domain d1hq4c2: 1hq4 C:108-214 [83626]
    Other proteins in same PDB: d1hq4a1, d1hq4b1, d1hq4b2, d1hq4c1, d1hq4d1, d1hq4d2
    part of catalytic Fab HA-19A4 with a polyene cyclase activity
    complexed with cd

Details for d1hq4c2

PDB Entry: 1hq4 (more details), 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4

SCOP Domain Sequences for d1hq4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq4c2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1hq4c2:

Click to download the PDB-style file with coordinates for d1hq4c2.
(The format of our PDB-style files is described here.)

Timeline for d1hq4c2: