SCOP 1.67: Domain d1hq4a2: 1hq4 A:108-214

Lineage for d1hq4a2 (1hq4 A:108-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1hq4a2: 1hq4 A:108-214 [83622]
   Other proteins in same PDB: d1hq4a1, d1hq4b1, d1hq4b2, d1hq4c1, d1hq4d1, d1hq4d2

Details for d1hq4a2

PDB Entry: 1hq4, 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4

SCOP Domain Sequences for d1hq4a2:

Sequence; same for both SEQRES and ATOM records:

>d1hq4a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1hq4a2:

• d1hq4a2 first appeared in SCOP 1.65
  
• d1hq4a2 appears in SCOP 1.69
  
• d1hq4a2 appears in the current release, SCOPe 2.08