Lineage for d1hq4a1 (1hq4 A:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757113Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)
  8. 1757119Domain d1hq4a1: 1hq4 A:1-107 [83621]
    Other proteins in same PDB: d1hq4a2, d1hq4b1, d1hq4b2, d1hq4c2, d1hq4d1, d1hq4d2
    part of catalytic Fab HA-19A4 with a polyene cyclase activity
    complexed with cd

Details for d1hq4a1

PDB Entry: 1hq4 (more details), 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4
PDB Compounds: (A:) antibody ha5-19a4 fab light chain

SCOPe Domain Sequences for d1hq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq4a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelk

SCOPe Domain Coordinates for d1hq4a1:

Click to download the PDB-style file with coordinates for d1hq4a1.
(The format of our PDB-style files is described here.)

Timeline for d1hq4a1: