Lineage for d1hn0a4 (1hn0 A:619-899)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664644Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 664645Protein Chondroitin ABC lyase I [89284] (1 species)
    domain 3
  7. 664646Species Proteus vulgaris [TaxId:585] [89285] (1 PDB entry)
  8. 664647Domain d1hn0a4: 1hn0 A:619-899 [83619]
    Other proteins in same PDB: d1hn0a1, d1hn0a2, d1hn0a3
    complexed with na

Details for d1hn0a4

PDB Entry: 1hn0 (more details), 1.9 Å

PDB Description: crystal structure of chondroitin abc lyase i from proteus vulgaris at 1.9 angstroms resolution
PDB Compounds: (A:) chondroitin abc lyase I

SCOP Domain Sequences for d1hn0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn0a4 b.30.5.2 (A:619-899) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]}
pqgfyafnggafgihrwqdkmvtlkayntnvwsseiynkdnrygryqshgvaqivsngsq
lsqgyqqegwdwnrmegattihlplkdldspkphtlmqrgergfsgtsslegqygmmafn
liypanlerfdpnftakksvlaadnhlifigsninssdknknvettlfqhaitptlntlw
ingqkienmpyqttlqqgdwlidsngngylitqaekvnvsrqhqvsaenknrqptegnfs
sawidhstrpkdasyeymvfldatpekmgemaqkfrenngl

SCOP Domain Coordinates for d1hn0a4:

Click to download the PDB-style file with coordinates for d1hn0a4.
(The format of our PDB-style files is described here.)

Timeline for d1hn0a4: