Lineage for d1hl6d_ (1hl6 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687107Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 1687108Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 1687109Family d.232.1.1: Mago nashi protein [89818] (1 protein)
  6. 1687110Protein Mago nashi protein [89819] (2 species)
  7. 1687111Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89820] (3 PDB entries)
  8. 1687115Domain d1hl6d_: 1hl6 D: [83612]
    Other proteins in same PDB: d1hl6a_, d1hl6c_

Details for d1hl6d_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex
PDB Compounds: (D:) mago nashi protein

SCOPe Domain Sequences for d1hl6d_:

Sequence, based on SEQRES records: (download)

>d1hl6d_ d.232.1.1 (D:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkri
iidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfy
ylvqdlkclvfsliglhfkikpipr

Sequence, based on observed residues (ATOM records): (download)

>d1hl6d_ d.232.1.1 (D:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dfylryyvghkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkriii
dseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyyl
vqdlkclvfsliglhfkikpipr

SCOPe Domain Coordinates for d1hl6d_:

Click to download the PDB-style file with coordinates for d1hl6d_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6d_: