Lineage for d1hl6c_ (1hl6 C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329151Protein CG8781 protein [89938] (1 species)
  7. 329152Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (2 PDB entries)
  8. 329155Domain d1hl6c_: 1hl6 C: [83611]
    Other proteins in same PDB: d1hl6b_, d1hl6d_

Details for d1hl6c_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex

SCOP Domain Sequences for d1hl6c_:

Sequence, based on SEQRES records: (download)

>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrsve
gwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqalaak
ealngaeimgqtiqvdwcfvk

Sequence, based on observed residues (ATOM records): (download)

>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk

SCOP Domain Coordinates for d1hl6c_:

Click to download the PDB-style file with coordinates for d1hl6c_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6c_: