SCOP 1.65: Domain d1hl6c_: 1hl6 C:

Lineage for d1hl6c_ (1hl6 C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (16 proteins)

6. Protein CG8781 protein [89938] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (2 PDB entries)

8. Domain d1hl6c_: 1hl6 C: [83611]
   Other proteins in same PDB: d1hl6b_, d1hl6d_

Details for d1hl6c_

PDB Entry: 1hl6, 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex

SCOP Domain Sequences for d1hl6c_:

Sequence, based on SEQRES records:

>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrsve
gwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqalaak
ealngaeimgqtiqvdwcfvk

Sequence, based on observed residues (ATOM records):

>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk

Timeline for d1hl6c_:

• d1hl6c_ is new in SCOP 1.65
  
• d1hl6c_ appears in SCOP 1.67
  
• d1hl6c_ appears in the current release, SCOPe 2.08