Lineage for d1hl6c_ (1hl6 C:)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (16 proteins) 
Protein CG8781 protein [89938] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (2 PDB entries) 
Domain d1hl6c_: 1hl6 C: [83611]
Other proteins in same PDB: d1hl6b_, d1hl6d_
Details for d1hl6c_
PDB Entry: 1hl6 (more details), 2.5 Å
PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex
SCOP Domain Sequences for d1hl6c_:
Sequence, based on SEQRES records: (download)
>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrsve
gwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqalaak
ealngaeimgqtiqvdwcfvk
Sequence, based on observed residues (ATOM records): (download)
>d1hl6c_ d.58.7.1 (C:) CG8781 protein {Fruit fly (Drosophila melanogaster)}
efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
SCOP Domain Coordinates for d1hl6c_:
Click to download the PDB-style file with coordinates for d1hl6c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hl6c_:
- d1hl6c_ is new in SCOP 1.65
- d1hl6c_ appears in SCOP 1.67
- d1hl6c_ appears in the current release, SCOPe 2.07
View in 3D
