Lineage for d1hl6b_ (1hl6 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240523Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 2240524Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 2240525Family d.232.1.1: Mago nashi protein [89818] (1 protein)
  6. 2240526Protein Mago nashi protein [89819] (2 species)
  7. 2240527Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89820] (3 PDB entries)
  8. 2240530Domain d1hl6b_: 1hl6 B: [83610]
    Other proteins in same PDB: d1hl6a_, d1hl6c_

Details for d1hl6b_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex
PDB Compounds: (B:) mago nashi protein

SCOPe Domain Sequences for d1hl6b_:

Sequence, based on SEQRES records: (download)

>d1hl6b_ d.232.1.1 (B:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr
iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf
yylvqdlkclvfsliglhfkikp

Sequence, based on observed residues (ATOM records): (download)

>d1hl6b_ d.232.1.1 (B:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
edfylryyvghkgkfgheflefefrpdgklryannsntmirkeafvhqsvmeelkriiid
seimqeddlpwpppdrvgrqeleivigdehisfttsktlvdvnrskdpeglrcfyylvqd
lkclvfsliglhfkikp

SCOPe Domain Coordinates for d1hl6b_:

Click to download the PDB-style file with coordinates for d1hl6b_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6b_: