Lineage for d1hl6a_ (1hl6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908703Protein RNA-binding protein 8 [89938] (2 species)
  7. 1908704Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
    CG8781 protein
  8. 1908707Domain d1hl6a_: 1hl6 A: [83609]
    Other proteins in same PDB: d1hl6b_, d1hl6d_

Details for d1hl6a_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex
PDB Compounds: (A:) cg8781 protein

SCOPe Domain Sequences for d1hl6a_:

Sequence, based on SEQRES records: (download)

>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrs
vegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqala
akealngaeimgqtiqvdwcfvk

Sequence, based on observed residues (ATOM records): (download)

>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf
cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk

SCOPe Domain Coordinates for d1hl6a_:

Click to download the PDB-style file with coordinates for d1hl6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6a_: