Lineage for d1hl6a_ (1hl6 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412443Protein RNA-binding protein 8 [89938] (2 species)
  7. 412444Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
    CG8781 protein
  8. 412447Domain d1hl6a_: 1hl6 A: [83609]
    Other proteins in same PDB: d1hl6b_, d1hl6d_

Details for d1hl6a_

PDB Entry: 1hl6 (more details), 2.5 Å

PDB Description: a novel mode of rbd-protein recognition in the y14-mago complex

SCOP Domain Sequences for d1hl6a_:

Sequence, based on SEQRES records: (download)

>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster)}
aeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrs
vegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqala
akealngaeimgqtiqvdwcfvk

Sequence, based on observed residues (ATOM records): (download)

>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster)}
aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf
cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk

SCOP Domain Coordinates for d1hl6a_:

Click to download the PDB-style file with coordinates for d1hl6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hl6a_: