Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (16 proteins) |
Protein CG8781 protein [89938] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (2 PDB entries) |
Domain d1hl6a_: 1hl6 A: [83609] Other proteins in same PDB: d1hl6b_, d1hl6d_ |
PDB Entry: 1hl6 (more details), 2.5 Å
SCOP Domain Sequences for d1hl6a_:
Sequence, based on SEQRES records: (download)
>d1hl6a_ d.58.7.1 (A:) CG8781 protein {Fruit fly (Drosophila melanogaster)} aeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrs vegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqala akealngaeimgqtiqvdwcfvk
>d1hl6a_ d.58.7.1 (A:) CG8781 protein {Fruit fly (Drosophila melanogaster)} aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
Timeline for d1hl6a_: