![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein RNA-binding protein 8 [89938] (2 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries) CG8781 protein |
![]() | Domain d1hl6a_: 1hl6 A: [83609] Other proteins in same PDB: d1hl6b_, d1hl6d_ |
PDB Entry: 1hl6 (more details), 2.5 Å
SCOPe Domain Sequences for d1hl6a_:
Sequence, based on SEQRES records: (download)
>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrnedddelepgpqrs vegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkqala akealngaeimgqtiqvdwcfvk
>d1hl6a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
Timeline for d1hl6a_: