Lineage for d1hkxn_ (1hkx N:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409086Superfamily d.17.4: NTF2-like [54427] (10 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 409237Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (1 protein)
  6. 409238Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (1 species)
  7. 409239Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry)
  8. 409253Domain d1hkxn_: 1hkx N: [83580]
    complexed with cl, dtt, tbr

Details for d1hkxn_

PDB Entry: 1hkx (more details), 2.65 Å

PDB Description: crystal structure of calcium/calmodulin-dependent protein kinase

SCOP Domain Sequences for d1hkxn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkxn_ d.17.4.7 (N:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus)}
dedtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyf
enlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrd
gkwqivhfhrsgapsv

SCOP Domain Coordinates for d1hkxn_:

Click to download the PDB-style file with coordinates for d1hkxn_.
(The format of our PDB-style files is described here.)

Timeline for d1hkxn_: