|  | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) | 
|  | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet | 
|  | Superfamily d.17.4: NTF2-like [54427] (12 families)  has a beta-alpha(2)-beta insertion after the main helix | 
|  | Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (1 protein) | 
|  | Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (1 species) | 
|  | Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry) | 
|  | Domain d1hkxk_: 1hkx K: [83577] | 
PDB Entry: 1hkx (more details), 2.65 Å
SCOP Domain Sequences for d1hkxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkxk_ d.17.4.7 (K:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus)}
edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
kwqivhfhrsgapsv
Timeline for d1hkxk_: