Lineage for d1hkxc_ (1hkx C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326465Superfamily d.17.4: NTF2-like [54427] (8 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 326608Family d.17.4.7: Association donain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (1 protein)
  6. 326609Protein Association donain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (1 species)
  7. 326610Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry)
  8. 326613Domain d1hkxc_: 1hkx C: [83569]

Details for d1hkxc_

PDB Entry: 1hkx (more details), 2.65 Å

PDB Description: crystal structure of calcium/calmodulin-dependent protein kinase

SCOP Domain Sequences for d1hkxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkxc_ d.17.4.7 (C:) Association donain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus)}
tiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhr
fyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwh
rrdgkwqivhfhrsgapsv

SCOP Domain Coordinates for d1hkxc_:

Click to download the PDB-style file with coordinates for d1hkxc_.
(The format of our PDB-style files is described here.)

Timeline for d1hkxc_: