Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.6: PLP-binding barrel [51419] (2 families) circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
Protein Diaminopimelate decarboxylase LysA [89457] (3 species) most similar to eukaryotic ODC |
Species Mycobacterium tuberculosis [TaxId:1773] [89458] (2 PDB entries) |
Domain d1hkwb2: 1hkw B:46-310 [83566] Other proteins in same PDB: d1hkwa1, d1hkwb1 complexed with so4 |
PDB Entry: 1hkw (more details), 2.8 Å
SCOPe Domain Sequences for d1hkwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkwb2 c.1.6.1 (B:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]} deddfrsrcretaaafgsganvhyaakaflcsevarwiseeglcldvctggelavalhas fpperitlhgnnksvseltaavkagvghivvdsmteierldaiageagivqdvlvrltvg veahthefistahedqkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfe laahrvigllrdvvgefgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsd estavglptpklvvepgraiagpgt
Timeline for d1hkwb2: