SCOP 1.67: Domain d1hkwb1: 1hkw B:3-45,B:311-446

Lineage for d1hkwb1 (1hkw B:3-45,B:311-446)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Diaminopimelate decarboxylase LysA [89350] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries)

8. Domain d1hkwb1: 1hkw B:3-45,B:311-446 [83565]
   Other proteins in same PDB: d1hkwa2, d1hkwb2
   complexed with mse, so4

Details for d1hkwb1

PDB Entry: 1hkw, 2.8 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)

SCOP Domain Sequences for d1hkwb1:

Sequence; same for both SEQRES and ATOM records:

>d1hkwb1 b.49.2.3 (B:3-45,B:311-446) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis}
ellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvsa
tahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdtw
vpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllslev

Timeline for d1hkwb1:

• d1hkwb1 first appeared in SCOP 1.65
  
• d1hkwb1 appears in SCOP 1.69
  
• d1hkwb1 appears in the current release, SCOPe 2.08