![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
![]() | Protein Diaminopimelate decarboxylase LysA [89457] (1 species) most similar to eukaryotic ODC |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [89458] (2 PDB entries) |
![]() | Domain d1hkvb2: 1hkv B:46-310 [83562] Other proteins in same PDB: d1hkva1, d1hkvb1 complexed with lys, plp |
PDB Entry: 1hkv (more details), 2.6 Å
SCOP Domain Sequences for d1hkvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkvb2 c.1.6.1 (B:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis} deddfrsrcretaaafgsganvhyaakaflcsevarwiseeglcldvctggelavalhas fpperitlhgnnksvseltaavkagvghivvdsmteierldaiageagivqdvlvrltvg veahthefistahedqkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfe laahrvigllrdvvgefgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsd estavglptpklvvepgraiagpgt
Timeline for d1hkvb2: