Lineage for d1hkvb2 (1hkv B:46-310)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305533Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 305534Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 305551Protein Diaminopimelate decarboxylase LysA [89457] (1 species)
    most similar to eukaryotic ODC
  7. 305552Species Mycobacterium tuberculosis [TaxId:1773] [89458] (2 PDB entries)
  8. 305554Domain d1hkvb2: 1hkv B:46-310 [83562]
    Other proteins in same PDB: d1hkva1, d1hkvb1
    complexed with lys, plp

Details for d1hkvb2

PDB Entry: 1hkv (more details), 2.6 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)

SCOP Domain Sequences for d1hkvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkvb2 c.1.6.1 (B:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis}
deddfrsrcretaaafgsganvhyaakaflcsevarwiseeglcldvctggelavalhas
fpperitlhgnnksvseltaavkagvghivvdsmteierldaiageagivqdvlvrltvg
veahthefistahedqkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfe
laahrvigllrdvvgefgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsd
estavglptpklvvepgraiagpgt

SCOP Domain Coordinates for d1hkvb2:

Click to download the PDB-style file with coordinates for d1hkvb2.
(The format of our PDB-style files is described here.)

Timeline for d1hkvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkvb1