Lineage for d1hkvb1 (1hkv B:2-45,B:311-447)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299710Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 299791Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 299809Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 299810Protein Diaminopimelate decarboxylase LysA [89350] (1 species)
  7. 299811Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries)
  8. 299813Domain d1hkvb1: 1hkv B:2-45,B:311-447 [83561]
    Other proteins in same PDB: d1hkva2, d1hkvb2
    complexed with lys, plp

Details for d1hkvb1

PDB Entry: 1hkv (more details), 2.6 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)

SCOP Domain Sequences for d1hkvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkvb1 b.49.2.3 (B:2-45,B:311-447) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis}
nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvs
atahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdt
wvpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllsle
vr

SCOP Domain Coordinates for d1hkvb1:

Click to download the PDB-style file with coordinates for d1hkvb1.
(The format of our PDB-style files is described here.)

Timeline for d1hkvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkvb2