Class b: All beta proteins [48724] (126 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Diaminopimelate decarboxylase LysA [89350] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries) |
Domain d1hkvb1: 1hkv B:2-45,B:311-447 [83561] Other proteins in same PDB: d1hkva2, d1hkvb2 complexed with lys, plp |
PDB Entry: 1hkv (more details), 2.6 Å
SCOP Domain Sequences for d1hkvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkvb1 b.49.2.3 (B:2-45,B:311-447) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis} nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvs atahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdt wvpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllsle vr
Timeline for d1hkvb1: