![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
![]() | Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [89351] (2 PDB entries) |
![]() | Domain d1hkva1: 1hkv A:2-45,A:311-447 [83559] Other proteins in same PDB: d1hkva2, d1hkvb2 complexed with lys, plp |
PDB Entry: 1hkv (more details), 2.6 Å
SCOPe Domain Sequences for d1hkva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkva1 b.49.2.3 (A:2-45,A:311-447) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]} nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfviXitlyevgtvkdvdvs atahrryvsvdggmsdnirtalygaqydvrlvsrvsdappvparlvgkhcesgdiivrdt wvpddirpgdlvavaatgaycyslssrynmvgrpavvavhagnarlvlrretvddllsle vr
Timeline for d1hkva1: