Lineage for d1hkqb_ (1hkq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306656Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 2306669Protein Replication protein A, repA [88982] (1 species)
  7. 2306670Species Pseudomonas syringae pv. savastanoi [TaxId:29438] [88983] (1 PDB entry)
  8. 2306672Domain d1hkqb_: 1hkq B: [83556]
    inactive, dimeric N-terminal domain
    complexed with bez, hg, po4

Details for d1hkqb_

PDB Entry: 1hkq (more details), 2.75 Å

PDB Description: pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.
PDB Compounds: (B:) replication protein

SCOPe Domain Sequences for d1hkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkqb_ a.4.5.10 (B:) Replication protein A, repA {Pseudomonas syringae pv. savastanoi [TaxId: 29438]}
qsnkliesshtltlnekrlvlcaaslidsrkplpkdgyltiradtfaevfgidvkhayaa
lddaatklfnrdirryvkgkvvermrwvfhvkyregqgcvelgfsptiiphltmlhkeft
syqlk

SCOPe Domain Coordinates for d1hkqb_:

Click to download the PDB-style file with coordinates for d1hkqb_.
(The format of our PDB-style files is described here.)

Timeline for d1hkqb_: