![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.10: Replication initiation protein [46816] (3 proteins) duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry |
![]() | Protein Replication protein A, repA [88982] (1 species) |
![]() | Species Pseudomonas syringae pv. savastanoi [TaxId:29438] [88983] (1 PDB entry) |
![]() | Domain d1hkqa_: 1hkq A: [83555] inactive, dimeric N-terminal domain complexed with bez, hg, po4 |
PDB Entry: 1hkq (more details), 2.75 Å
SCOPe Domain Sequences for d1hkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkqa_ a.4.5.10 (A:) Replication protein A, repA {Pseudomonas syringae pv. savastanoi [TaxId: 29438]} qsnkliesshtltlnekrlvlcaaslidsrkplpkdgyltiradtfaevfgidvkhayaa lddaatklfnrdirryvkgkvvermrwvfhvkyregqgcvelgfsptiiphltmlhkeft syqlk
Timeline for d1hkqa_: