SCOP 1.65: Domain d1hkqa_: 1hkq A:

Lineage for d1hkqa_ (1hkq A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.10: Replication initiation protein [46816] (2 proteins)
   duplication: tandem repeat of two "winged helix" domains arraged with the pseudo twofold symmetry

6. Protein Replication protein A, repA [88982] (1 species)

7. Species Pseudomonas syringae pv. savastanoi [TaxId:29438] [88983] (1 PDB entry)

8. Domain d1hkqa_: 1hkq A: [83555]

Details for d1hkqa_

PDB Entry: 1hkq, 2.75 Å

PDB Description: pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.

SCOP Domain Sequences for d1hkqa_:

Sequence; same for both SEQRES and ATOM records:

>d1hkqa_ a.4.5.10 (A:) Replication protein A, repA {Pseudomonas syringae pv. savastanoi}
qsnkliesshtltlnekrlvlcaaslidsrkplpkdgyltiradtfaevfgidvkhayaa
lddaatklfnrdirryvkgkvvermrwvfhvkyregqgcvelgfsptiiphltmlhkeft
syqlk

Timeline for d1hkqa_:

• d1hkqa_ is new in SCOP 1.65
  
• d1hkqa_ appears in SCOP 1.67
  
• d1hkqa_ appears in the current release, SCOPe 2.08