Lineage for d1hkoa_ (1hko A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333747Fold d.120: Cytochrome b5 [55855] (1 superfamily)
    small, heme-binding fold
  4. 333748Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 333749Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 333750Protein Cytochrome b5 [55858] (3 species)
  7. 333751Species Cow (Bos taurus) [TaxId:9913] [55859] (13 PDB entries)
  8. 333764Domain d1hkoa_: 1hko A: [83554]
    complexed with hem

Details for d1hkoa_

PDB Entry: 1hko (more details)

PDB Description: nmr structure of bovine cytochrome b5

SCOP Domain Sequences for d1hkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)}
aeesskavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdate
nfedvghstdarelsktfiigelhpddrskitkpsesiittids

SCOP Domain Coordinates for d1hkoa_:

Click to download the PDB-style file with coordinates for d1hkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1hkoa_: