Lineage for d1hkd.2 (1hkd C:,D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2049903Protein Legume lectin [49904] (23 species)
  7. 2050066Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2050074Domain d1hkd.2: 1hkd C:,D: [83548]
    complexed with ca, gyp, mn

Details for d1hkd.2

PDB Entry: 1hkd (more details), 2.09 Å

PDB Description: structure of pea lectin in complex with alpha-methyl-d-glucopyranoside
PDB Compounds: (C:) pea lectin alpha chain, (D:) pea lectin beta chain

SCOPe Domain Sequences for d1hkd.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hkd.2 b.29.1.1 (C:,D:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt

SCOPe Domain Coordinates for d1hkd.2:

Click to download the PDB-style file with coordinates for d1hkd.2.
(The format of our PDB-style files is described here.)

Timeline for d1hkd.2: