SCOPe 2.06: Domain d1hkd.1: 1hkd A:,B:

Lineage for d1hkd.1 (1hkd A:,B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d1hkd.1: 1hkd A:,B: [83547]
   complexed with ca, gyp, mn

Details for d1hkd.1

PDB Entry: 1hkd, 2.09 Å

PDB Description: structure of pea lectin in complex with alpha-methyl-d-glucopyranoside

PDB Compounds: (A:) pea lectin alpha chain, (B:) pea lectin beta chain

SCOPe Domain Sequences for d1hkd.1:

Sequence; same for both SEQRES and ATOM records:

>g1hkd.1 b.29.1.1 (A:,B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt

Timeline for d1hkd.1:

• d1hkd.1 first appeared in SCOP 1.65
  
• d1hkd.1 appears in SCOPe 2.05
  
• d1hkd.1 appears in SCOPe 2.07
  
• d1hkd.1 appears in the current release, SCOPe 2.08