Lineage for d1hkd.1 (1hkd A:,B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663427Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 663434Domain d1hkd.1: 1hkd A:,B: [83547]

Details for d1hkd.1

PDB Entry: 1hkd (more details), 2.09 Å

PDB Description: structure of pea lectin in complex with alpha-methyl-d-glucopyranoside
PDB Compounds: (A:) pea lectin alpha chain, (B:) pea lectin beta chain

SCOP Domain Sequences for d1hkd.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hkd.1 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt

SCOP Domain Coordinates for d1hkd.1:

Click to download the PDB-style file with coordinates for d1hkd.1.
(The format of our PDB-style files is described here.)

Timeline for d1hkd.1: