Lineage for d1hk8a_ (1hk8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097842Family c.7.1.3: Class III anaerobic ribonucleotide reductase NRDD subunit [52005] (2 protein domains)
    automatically mapped to Pfam PF13597
  6. 2097843Protein Class III anaerobic ribonucleotide reductase NRDD subunit [52006] (1 species)
  7. 2097844Species Bacteriophage T4 [TaxId:10665] [52007] (6 PDB entries)
  8. 2097845Domain d1hk8a_: 1hk8 A: [83540]
    complexed with dgt, mn, zn

Details for d1hk8a_

PDB Entry: 1hk8 (more details), 2.45 Å

PDB Description: structural basis for allosteric substrate specificity regulation in class iii ribonucleotide reductases: nrdd in complex with dgtp
PDB Compounds: (A:) anaerobic ribonucleotide-triphosphate reductase

SCOPe Domain Sequences for d1hk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hk8a_ c.7.1.3 (A:) Class III anaerobic ribonucleotide reductase NRDD subunit {Bacteriophage T4 [TaxId: 10665]}
dsrvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlk
gmlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtya
khiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtitfgtgtdw
termiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrm
ypdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlpriald
syigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpddd
iielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpa
enlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghi
syvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcftcgsthemtptengfvcsicg
etdpkkmntirrtcaylgnpn

SCOPe Domain Coordinates for d1hk8a_:

Click to download the PDB-style file with coordinates for d1hk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hk8a_: