Lineage for d1hk6a_ (1hk6 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456617Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein)
    apart from the domains of transcription factors and sugar-utilizing enzymes
  6. 456618Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species)
  7. 456619Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries)
  8. 456622Domain d1hk6a_: 1hk6 A: [83539]

Details for d1hk6a_

PDB Entry: 1hk6 (more details)

PDB Description: ral binding domain from sec5

SCOP Domain Sequences for d1hk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hk6a_ b.1.18.18 (A:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus)}
hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivc
rvgqakndkgdiivttksggkgtstvsfkllkpek

SCOP Domain Coordinates for d1hk6a_:

Click to download the PDB-style file with coordinates for d1hk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hk6a_: