SCOP 1.67: Domain d1hk6a_: 1hk6 A:

Lineage for d1hk6a_ (1hk6 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.18: Other IPT/TIG domains [89191] (1 protein)
   apart from the domains of transcription factors and sugar-utilizing enzymes

6. Protein Exocyst complex component Sec5, Ral-binding domain [89192] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89193] (2 PDB entries)

8. Domain d1hk6a_: 1hk6 A: [83539]

Details for d1hk6a_

PDB Entry: 1hk6

PDB Description: ral binding domain from sec5

SCOP Domain Sequences for d1hk6a_:

Sequence; same for both SEQRES and ATOM records:

>d1hk6a_ b.1.18.18 (A:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus)}
hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivc
rvgqakndkgdiivttksggkgtstvsfkllkpek

Timeline for d1hk6a_:

• d1hk6a_ first appeared in SCOP 1.65
  
• d1hk6a_ appears in SCOP 1.69
  
• d1hk6a_ appears in the current release, SCOPe 2.08