SCOPe 2.05: Domain d1hk5a1: 1hk5 A:3-196

Lineage for d1hk5a1 (1hk5 A:3-196)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
   Uniprot P02768 29-596

8. Domain d1hk5a1: 1hk5 A:3-196 [83536]
   complexed with myr, t44; mutant

Details for d1hk5a1

PDB Entry: 1hk5, 2.7 Å

PDB Description: human serum albumin mutant r218h complexed with thyroxine (3,3',5,5'-tetraiodo-l-thyronine) and myristic acid (tetradecanoic acid)

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1hk5a1:

Sequence; same for both SEQRES and ATOM records:

>d1hk5a1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d1hk5a1:

• d1hk5a1 first appeared in SCOP 1.65
  
• d1hk5a1 appears in SCOPe 2.04
  
• d1hk5a1 appears in SCOPe 2.06
  
• d1hk5a1 appears in the current release, SCOPe 2.08