Lineage for d1hk2a1 (1hk2 A:5-196)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360670Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 360671Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 360672Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 360673Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 360674Species Human (Homo sapiens) [TaxId:9606] [48555] (25 PDB entries)
  8. 360729Domain d1hk2a1: 1hk2 A:5-196 [83527]

Details for d1hk2a1

PDB Entry: 1hk2 (more details), 2.8 Å

PDB Description: human serum albumin mutant r218h complexed with thyroxine (3,3',5,5'- tetraiodo-l-thyronine)

SCOP Domain Sequences for d1hk2a1:

Sequence, based on SEQRES records: (download)

>d1hk2a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens)}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d1hk2a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens)}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctdccakqepernecflqhkddnpnlprlvrpevdvmctafhdneetflk
kylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegkassakq

SCOP Domain Coordinates for d1hk2a1:

Click to download the PDB-style file with coordinates for d1hk2a1.
(The format of our PDB-style files is described here.)

Timeline for d1hk2a1: