Lineage for d1hk1a2 (1hk1 A:197-388)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285651Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulphide-linked subdomains
  4. 285652Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 285653Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 285654Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 285655Species Human (Homo sapiens) [TaxId:9606] [48555] (25 PDB entries)
  8. 285696Domain d1hk1a2: 1hk1 A:197-388 [83525]

Details for d1hk1a2

PDB Entry: 1hk1 (more details), 2.65 Å

PDB Description: human serum albumin complexed with thyroxine (3,3',5,5'-tetraiodo-l- thyronine)

SCOP Domain Sequences for d1hk1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hk1a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens)}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1hk1a2:

Click to download the PDB-style file with coordinates for d1hk1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hk1a2: