Lineage for d1hk0x1 (1hk0 X:1-85)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetrySuperfamily b.11.1: gamma-Crystallin-like [49695] (7 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) Protein gamma-Crystallin [49697] (9 species)
duplication consists of two domains of this fold
Species Human (Homo sapiens), isoform D [TaxId:9606] [89230] (3 PDB entries) 
Domain d1hk0x1: 1hk0 X:1-85 [83522]
Details for d1hk0x1
PDB Entry: 1hk0 (more details), 1.25 Å
PDB Description: human gammad crystallin structure at 1.25 a resolution
PDB Compounds: (X:) Gamma-crystallin DSCOPe Domain Sequences for d1hk0x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hk0x1 b.11.1.1 (X:1-85) gamma-Crystallin {Human (Homo sapiens), isoform D [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsg
SCOPe Domain Coordinates for d1hk0x1:
Click to download the PDB-style file with coordinates for d1hk0x1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hk0x1:
- d1hk0x1 first appeared in SCOP 1.65
- d1hk0x1 appears in SCOPe 2.07
View in 3D
