| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries) |
| Domain d1hjxd2: 1hjx D:261-328 [83519] Other proteins in same PDB: d1hjxa1, d1hjxb1, d1hjxc1, d1hjxd1 complexed with gol, so4 |
PDB Entry: 1hjx (more details), 1.85 Å
SCOPe Domain Sequences for d1hjxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjxd2 d.26.3.1 (D:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy
Timeline for d1hjxd2: