Lineage for d1hjxc1 (1hjx C:22-260,C:329-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083262Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 2083263Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 2083266Domain d1hjxc1: 1hjx C:22-260,C:329-383 [83516]
    Other proteins in same PDB: d1hjxa2, d1hjxb2, d1hjxc2, d1hjxd2
    complexed with gol, so4

Details for d1hjxc1

PDB Entry: 1hjx (more details), 1.85 Å

PDB Description: Ligand-induced signalling and conformational change of the 39 kD glycoprotein from human articular chondrocytes
PDB Compounds: (C:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjxc1:

Sequence, based on SEQRES records: (download)

>d1hjxc1 c.1.8.5 (C:22-260,C:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

Sequence, based on observed residues (ATOM records): (download)

>d1hjxc1 c.1.8.5 (C:22-260,C:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeakkqlllsaalsagkvtidssydiakisqhldfisim
tydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptXddq
esvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOPe Domain Coordinates for d1hjxc1:

Click to download the PDB-style file with coordinates for d1hjxc1.
(The format of our PDB-style files is described here.)

Timeline for d1hjxc1: