SCOP 1.69: Domain d1hjxb2: 1hjx B:261-328

Lineage for d1hjxb2 (1hjx B:261-328)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)

8. Domain d1hjxb2: 1hjx B:261-328 [83515]
   Other proteins in same PDB: d1hjxa1, d1hjxb1, d1hjxc1, d1hjxd1

Details for d1hjxb2

PDB Entry: 1hjx, 1.85 Å

PDB Description: ligand-induced signalling and conformational change of the 39 kd glycoprotein from human articular chondrocytes

SCOP Domain Sequences for d1hjxb2:

Sequence; same for both SEQRES and ATOM records:

>d1hjxb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

Timeline for d1hjxb2:

• d1hjxb2 first appeared in SCOP 1.65
  
• d1hjxb2 appears in SCOP 1.67
  
• d1hjxb2 appears in SCOP 1.71
  
• d1hjxb2 appears in the current release, SCOPe 2.08