![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries) |
![]() | Domain d1hjxa2: 1hjx A:261-328 [83513] Other proteins in same PDB: d1hjxa1, d1hjxb1, d1hjxc1, d1hjxd1 |
PDB Entry: 1hjx (more details), 1.85 Å
SCOP Domain Sequences for d1hjxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjxa2 d.26.3.1 (A:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)} fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat kgnqwvgy
Timeline for d1hjxa2: