Lineage for d1hjwb2 (1hjw B:261-328)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327256Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 327386Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 327387Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 327436Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 327437Species Human (Homo sapiens) [TaxId:9606] [89885] (3 PDB entries)
  8. 327443Domain d1hjwb2: 1hjw B:261-328 [83511]
    Other proteins in same PDB: d1hjwa1, d1hjwb1
    complexed with gol, nag, so4

Details for d1hjwb2

PDB Entry: 1hjw (more details), 2.3 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin octamer

SCOP Domain Sequences for d1hjwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjwb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOP Domain Coordinates for d1hjwb2:

Click to download the PDB-style file with coordinates for d1hjwb2.
(The format of our PDB-style files is described here.)

Timeline for d1hjwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hjwb1