Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89885] (3 PDB entries) |
Domain d1hjwb2: 1hjw B:261-328 [83511] Other proteins in same PDB: d1hjwa1, d1hjwb1 complexed with gol, nag, so4 |
PDB Entry: 1hjw (more details), 2.3 Å
SCOP Domain Sequences for d1hjwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjwb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)} fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat kgnqwvgy
Timeline for d1hjwb2: