SCOP 1.65: Domain d1hjwb1: 1hjw B:22-260,B:329-383

Lineage for d1hjwb1 (1hjw B:22-260,B:329-383)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89483] (3 PDB entries)

8. Domain d1hjwb1: 1hjw B:22-260,B:329-383 [83510]
   Other proteins in same PDB: d1hjwa2, d1hjwb2
   complexed with gol, nag, so4

Details for d1hjwb1

PDB Entry: 1hjw, 2.3 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin octamer

SCOP Domain Sequences for d1hjwb1:

Sequence; same for both SEQRES and ATOM records:

>d1hjwb1 c.1.8.5 (B:22-260,B:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

Timeline for d1hjwb1:

• d1hjwb1 is new in SCOP 1.65
  
• d1hjwb1 appears in SCOP 1.67
  
• d1hjwb1 appears in the current release, SCOPe 2.08