Lineage for d1hjwa2 (1hjw A:261-328)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327256Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 327386Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 327387Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 327436Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 327437Species Human (Homo sapiens) [TaxId:9606] [89885] (3 PDB entries)
  8. 327442Domain d1hjwa2: 1hjw A:261-328 [83509]
    Other proteins in same PDB: d1hjwa1, d1hjwb1

Details for d1hjwa2

PDB Entry: 1hjw (more details), 2.3 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin octamer

SCOP Domain Sequences for d1hjwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjwa2 d.26.3.1 (A:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOP Domain Coordinates for d1hjwa2:

Click to download the PDB-style file with coordinates for d1hjwa2.
(The format of our PDB-style files is described here.)

Timeline for d1hjwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hjwa1