Lineage for d1hjvc1 (1hjv C:22-260,C:329-383)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306400Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 306401Species Human (Homo sapiens) [TaxId:9606] [89483] (3 PDB entries)
  8. 306410Domain d1hjvc1: 1hjv C:22-260,C:329-383 [83504]
    Other proteins in same PDB: d1hjva2, d1hjvb2, d1hjvc2, d1hjvd2

Details for d1hjvc1

PDB Entry: 1hjv (more details), 2.75 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin tetramer

SCOP Domain Sequences for d1hjvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjvc1 c.1.8.5 (C:22-260,C:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOP Domain Coordinates for d1hjvc1:

Click to download the PDB-style file with coordinates for d1hjvc1.
(The format of our PDB-style files is described here.)

Timeline for d1hjvc1: