![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
![]() | Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89483] (8 PDB entries) |
![]() | Domain d1hjvc1: 1hjv C:22-260,C:329-383 [83504] Other proteins in same PDB: d1hjva2, d1hjvb2, d1hjvc2, d1hjvd2 complexed with nag, so4 |
PDB Entry: 1hjv (more details), 2.75 Å
SCOPe Domain Sequences for d1hjvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjvc1 c.1.8.5 (C:22-260,C:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]} yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat
Timeline for d1hjvc1: