| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89885] (8 PDB entries) |
| Domain d1hjva2: 1hjv A:261-328 [83501] Other proteins in same PDB: d1hjva1, d1hjvb1, d1hjvc1, d1hjvd1 complexed with nag, so4 |
PDB Entry: 1hjv (more details), 2.75 Å
SCOPe Domain Sequences for d1hjva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjva2 d.26.3.1 (A:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy
Timeline for d1hjva2: