Lineage for d1hjva1 (1hjv A:22-260,A:329-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083262Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 2083263Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 2083286Domain d1hjva1: 1hjv A:22-260,A:329-383 [83500]
    Other proteins in same PDB: d1hjva2, d1hjvb2, d1hjvc2, d1hjvd2
    complexed with nag, so4

Details for d1hjva1

PDB Entry: 1hjv (more details), 2.75 Å

PDB Description: Crystal structure of hcgp-39 in complex with chitin tetramer
PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjva1 c.1.8.5 (A:22-260,A:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOPe Domain Coordinates for d1hjva1:

Click to download the PDB-style file with coordinates for d1hjva1.
(The format of our PDB-style files is described here.)

Timeline for d1hjva1: